ETV6 Rabbit Polyclonal Antibody

• Catalog Number: orb592884
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ETV6
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ETV6
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 53kDa
• Target: ETV6
• UniProt ID: P41212
• Protein Sequence: Synthetic peptide located within the following region: VSVSPPEEHAMPIGRIADCRLLWDYVYQLLSDSRYENFIRWEDKESKIFR
• NCBI: NP_001978
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: TEL, THC5, TEL/ABL
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Small Intestine, Antibody Dilution: 1 ug/ml.

Positive control (+): Mouse Spleen (M-SP), Negative control (-): Mouse Brain (M-BR), Antibody concentration: 1 ug/ml.

Human Stomach

WB Suggested Anti-ETV6 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate.