ERVW-1 Rabbit Polyclonal Antibody

SKU: orb330500

Description

Rabbit polyclonal antibody to ERVW-1

Research Area

Cell Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ERVW-1
• Target: ERVW-1
• Protein Sequence: Synthetic peptide located within the following region: CMTSSSPYQEFLWRMQRPGNIDAPSYRSLSKGTPTFTAHTHMPRNCYHSA
• Molecular Weight: 60 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti ENV antibody, anti ENVW antibody, anti ERVWE1 antibody, anti HERV-7q antibody, anti HERV-W-ENV antibody, anti HERV7Q antibody, anti HERVW antibody, anti HERVWENV antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

Sample Type: HT1080 Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.

Positive control (+): Human Placenta (PL), Negative control (-): 293T (2T), Antibody concentration: 1 ug/mL.

Quick Database Links

Gene Symbol

ERVW-1

UniProt

Q9UQF0

RefSeq (Protein):NP_055405