You have no items in your shopping cart.
Cart summary
Eras Peptide - N-terminal region
Catalog Number: orb2010831
Product Properties
| Catalog Number | orb2010831 |
|---|---|
| Category | Proteins |
| Description | Eras Peptide - N-terminal region |
| Predicted Reactivity | Mouse |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | LPTKSSILDLSSGTPCTRSPEESHEAWAQCKDAGRQLPEYKAVVVGASGV |
| UniProt ID | Q7TN89 |
| MW | 25kDa |
| Tested applications | WB |
| Application notes | This is a synthetic peptide designed for use in combination with Eras Rabbit Polyclonal Antibody (orb582892). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | HRAS2, HRasp, Ha-Ras2, ecat5 |
| Note | For research use only |
| NCBI | NP_853526 |
Images
Reviews
Eras Peptide - N-terminal region (orb2010831)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review