You have no items in your shopping cart.
Description
Research Area
Cardiovascular Research; Cell Biology
Images & Validation
−
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Equine |
| Target | VEGF-A |
| Protein Length | 164.0 |
| MW | 19.2 kDa |
| Purity | 98% |
| Protein Sequence | APMAEGEHKTHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTAEFNITMQIMRIKPHQSQHIGEMSFLQHSKCECRPKKDKARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR (164) |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−eVEGF Protein [orb1471907]
Greater than 95.0% as determined by SDS-PAGE.
Escherichia Coli
10 μg, 50 μg, 100 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
VEGF-A
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days