Equine VEGF-A protein

• Catalog Number: orb1216277
• Category: Proteins
• Description: The Equine VEGF-A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine VEGF-A applications are for cell culture, ELISA standard, and Western Blot Control. The Equine VEGF-A yeast-derived recombinant protein can be purchased in multiple sizes. Equine VEGF-A Specifications: (Molecular Weight: 19.2 kDa) (Amino Acid Sequence: APMAEGEHKTHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTAEFNITMQIMRIKPHQSQHIGEMSFLQHSKCECRPKKDKARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR (164)) (Gene ID: 100033839).
• Target: VEGF-A
• Form/Appearance: Lyophilized
• Purity: 98%
• Protein Sequence: APMAEGEHKTHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTAEFNITMQIMRIKPHQSQHIGEMSFLQHSKCECRPKKDKARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR (164)
• Protein Length: 164
• MW: 19.2 kDa
• Source: Yeast
• Biological Origin: Equine
• Storage: -20°C
• Note: For research use only