You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1215716 |
---|---|
Category | Proteins |
Description | The Equine IL-5 Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-5 Biotinylated applications are for cell culture. Equine IL-5 Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-5 Biotinylated Specifications: (Molecular Weight: 12.9 kDa) (Amino Acid Sequence: AVESPMNRLVAETLTLLSTHRTLLIGDGNLMIPTPEHKNHQLCIEEVFQGIDTLKNQTVQGDAVAKLFQNLSLIKGYIDLQKKKCGGERWRVKQFLDYLQEFLGVINTEWTIEG) (Gene ID: 100034199). |
Target | IL-5 |
Form/Appearance | Lyophilized |
Purity | 98% |
Protein Sequence | AVESPMNRLVAETLTLLSTHRTLLIGDGNLMIPTPEHKNHQLCIEEVFQGIDTLKNQTVQGDAVAKLFQNLSLIKGYIDLQKKKCGGERWRVKQFLDYLQEFLGVINTEWTIEG |
Protein Length | 114 |
MW | 12.9 kDa |
Source | Yeast |
Biological Origin | Equine |
Storage | -20°C |
Note | For research use only |