You have no items in your shopping cart.
Cart summary
Equine IL-1ra protein
Catalog Number: orb1216234
| Catalog Number | orb1216234 |
|---|---|
| Category | Proteins |
| Description | The Equine IL-1 Receptor Antagonist yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-1 Receptor Antagonist applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-1 Receptor Antagonist yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-1 Receptor Antagonist Specifications: (Molecular Weight: 17.4 kDa) (Amino Acid Sequence: HPLGKRPCKMQAFRIWDVNQKTFYMRNNQLVAGYLQESNTKLQEKIDVVPIEPDALFLGLHGRKLCLACVKSGDEIRFQLEAVNITDLSKNKEENKRFTFIRSNSGPTTSFESAACPGWFLCTAQEADRPVSLTNKPKESFMVTKFYLQEDQ (152)) (Gene ID: 100034236). |
| Target | IL-1ra |
| Form/Appearance | Lyophilized |
| Purity | 98% |
| Protein Sequence | HPLGKRPCKMQAFRIWDVNQKTFYMRNNQLVAGYLQESNTKLQEKIDVVPIEPDALFLGLHGRKLCLACVKSGDEIRFQLEAVNITDLSKNKEENKRFTFIRSNSGPTTSFESAACPGWFLCTAQEADRPVSLTNKPKESFMVTKFYLQEDQ (152) |
| Protein Length | 152 |
| MW | 17.4 kDa |
| Source | Yeast |
| Biological Origin | Equine |
| Storage | -20°C |
| Alternative names | IL-1F3 |
| Note | For research use only |
- Item 1 of 1
Equine IL-1RA protein [orb223895]
SDS-PAGE
Unconjugated
> 95% by SDS-PAGE and HPLC analyses.
17.4 kDa
E. coli
5 μg, 100 μg, 500 μg
