Cart summary

You have no items in your shopping cart.

Equine IL-1ra protein

SKU: orb1216234

Description

The Equine IL-1 Receptor Antagonist yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-1 Receptor Antagonist applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-1 Receptor Antagonist yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-1 Receptor Antagonist Specifications: (Molecular Weight: 17.4 kDa) (Amino Acid Sequence: HPLGKRPCKMQAFRIWDVNQKTFYMRNNQLVAGYLQESNTKLQEKIDVVPIEPDALFLGLHGRKLCLACVKSGDEIRFQLEAVNITDLSKNKEENKRFTFIRSNSGPTTSFESAACPGWFLCTAQEADRPVSLTNKPKESFMVTKFYLQEDQ (152)) (Gene ID: 100034236).

Images & Validation

Key Properties

SourceYeast
Biological OriginEquine
TargetIL-1ra
Molecular Weight17.4 kDa
Protein Length152.0
Protein SequenceHPLGKRPCKMQAFRIWDVNQKTFYMRNNQLVAGYLQESNTKLQEKIDVVPIEPDALFLGLHGRKLCLACVKSGDEIRFQLEAVNITDLSKNKEENKRFTFIRSNSGPTTSFESAACPGWFLCTAQEADRPVSLTNKPKESFMVTKFYLQEDQ (152)
Purity98%

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
DisclaimerFor research use only

Alternative Names

IL-1F3

Similar Products

  • Equine IL-1ra ELISA Kit [orb2991683]

    Equine

    0.3-20 ng/mL

    <50 pg/mL

    96 T
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Equine IL-1ra protein (orb1216234)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
$ 300.00
25 μg
$ 540.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry