You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1216234 |
---|---|
Category | Proteins |
Description | The Equine IL-1 Receptor Antagonist yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-1 Receptor Antagonist applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-1 Receptor Antagonist yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-1 Receptor Antagonist Specifications: (Molecular Weight: 17.4 kDa) (Amino Acid Sequence: HPLGKRPCKMQAFRIWDVNQKTFYMRNNQLVAGYLQESNTKLQEKIDVVPIEPDALFLGLHGRKLCLACVKSGDEIRFQLEAVNITDLSKNKEENKRFTFIRSNSGPTTSFESAACPGWFLCTAQEADRPVSLTNKPKESFMVTKFYLQEDQ (152)) (Gene ID: 100034236). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 17.4 kDa |
Target | IL-1ra |
Entrez | 100034236 |
Protein Sequence | HPLGKRPCKMQAFRIWDVNQKTFYMRNNQLVAGYLQESNTKLQEKIDVVPIEPDALFLGLHGRKLCLACVKSGDEIRFQLEAVNITDLSKNKEENKRFTFIRSNSGPTTSFESAACPGWFLCTAQEADRPVSLTNKPKESFMVTKFYLQEDQ (152) |
Protein Length | 152 |
Source | Yeast |
Storage | -20°C |
Alternative names | IL-1F3 Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
SDS-PAGE | |
Unconjugated | |
> 95% by SDS-PAGE and HPLC analyses. | |
17.4 kDa | |
E. coli |
Filter by Rating