You have no items in your shopping cart.
Cart summary
Equine CXCL10 protein
Catalog Number: orb1216359
| Catalog Number | orb1216359 |
|---|---|
| Category | Proteins |
| Description | The Equine CXCL10 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CXCL10 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CXCL10 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CXCL10 Specifications: (Molecular Weight: 9.4 kDa) (Amino Acid Sequence: IPLSRTARCTCINISDRPIPPRSLEKLEMIPASQSCQRVEIIATMKKNGEKRCLNPESKTVKNLLKAISKQRSKRSPRTLREV) (Gene ID: 100050993). |
| Target | CXCL10 |
| Form/Appearance | Lyophilized |
| Purity | 98% |
| Protein Sequence | IPLSRTARCTCINISDRPIPPRSLEKLEMIPASQSCQRVEIIATMKKNGEKRCLNPESKTVKNLLKAISKQRSKRSPRTLREV |
| Protein Length | 83 |
| MW | 9.4 kDa |
| Source | Yeast |
| Biological Origin | Equine |
| Storage | -20°C |
| Alternative names | IP-10 |
| Note | For research use only |
Equine CXCL10 ELISA Kit [orb1216620]
Equine
1 set (2 x capture antibody), 1 set (1 x capture antibody)
