You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb586413 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to EMILIN3 |
Target | EMILIN3 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human EMILIN3 |
Protein Sequence | Synthetic peptide located within the following region: QYSDAFLAANTSLDERERKVEAEVQAIQEQVSSQGSRLQAGHRQVLNLRG |
UniProt ID | Q9NT22 |
MW | 80kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | EMILIN5, C20orf130, dJ620E11.4 |
Note | For research use only |
NCBI | NP_443078 |
WB Suggested Anti-EMILIN3 Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell.
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
FITC |