You have no items in your shopping cart.
Cart summary
Efnb3 Peptide - C-terminal region
Catalog Number: orb2005313
| Catalog Number | orb2005313 |
|---|---|
| Category | Proteins |
| Description | Efnb3 Peptide - C-terminal region |
| Tested applications | WB |
| Predicted Reactivity | Human, Mouse |
| Form/Appearance | Lyophilized powder |
| MW | 36kDa |
| UniProt ID | O35393 |
| Protein Sequence | Synthetic peptide located within the following region: AGAGGAMCWRRRRAKPSESRHPGPGSFGRGGSLGLGGGGGMGPREAEPGE |
| NCBI | NP_031937 |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Buffer/Preservatives | Lyophilized powder |
| Alternative names | EFL-6, ELF-3, Elk-L3, Epl8, LERK-8, NLERK-2 Read more... |
| Note | For research use only |
| Application notes | This is a synthetic peptide designed for use in combination with Efnb3 Rabbit Polyclonal Antibody (orb585763). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Expiration Date | 6 months from date of receipt. |
