You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579792 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to EFNB1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Guinea pig, Rabbit, Rat |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human EFNB1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 38 kDa |
Target | EFNB1 |
UniProt ID | P98172 |
Protein Sequence | Synthetic peptide located within the following region: SRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSG |
NCBI | NP_004420 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CFND, CFNS, EFB1, EFL3, EPLG2, Elk-L, LERK2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Ephrin-B1 is a 38 kDa protein processed into a 35 kDa form. Recommended dilution for this antibody is 1-3 ug/ml.
Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.
Sample Tissue: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.
Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.
Positive control (+): Human Placenta (PL), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml.
WB Suggested Anti-EFNB1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human kidney.
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |