You have no items in your shopping cart.
Cart summary
EEF2KMT Peptide - C-terminal region
Catalog Number: orb2004975
| Catalog Number | orb2004975 |
|---|---|
| Category | Proteins |
| Description | EEF2KMT Peptide - C-terminal region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: CPEAIMSLVGVLRRLAACREHQRAPEVYVAFTVRNPETCQLFTTELGRAG |
| UniProt ID | K7ES84 |
| MW | 29kDa |
| Tested applications | WB |
| Application notes | This is a synthetic peptide designed for use in combination with EEF2KMT Rabbit Polyclonal Antibody (orb587395). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | SB153, FAM86A, eEF2-KMT |
| Note | For research use only |
| NCBI | NP_001275958.1 |
