Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 5-10 working days
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name E. coli TXN1 protein
Catalog Number orb429039
ReactivityE. coli
ConjugationUnconjugated
Target TXN1
Product Properties
Form/Appearance Sterile Lyophilized Powder.
Each mg of protein contains 20mM phosphate buffer pH 7.4.
Storage Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Note For research use only.
Protein Sequence HMSDKIIHL TDDSFDTDVLKADGAIL VDFW AEWCGPCKMIAPILDEI GKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGAL DANLA.
Purity >90.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Source Escherichia Coli.
Activity TRX activity is assayed by measuring the change in absorbance at 650 nm at 25°C using 0.13μM bovine insulin containing 0.33mM DTT (pH 6.5).The specific activity was found to be 3IU/mg.
Product Description

Recombinant of e. coli TXN1 protein

Solubility (25°C)
Solubility (25°C) It is recommended to reconstitute the lyophilized TRX in sterile 18MΩ-cm H2O.
Reviews
Write Your Own Review
You're reviewing:E. coli TXN1 protein - orb429039
Your Rating