Cart summary

You have no items in your shopping cart.

E. coli TXN1 Protein

SKU: orb429039

Description

Recombinant of e. coli TXN1 protein

Images & Validation

Application Notes
Recombinant & Natural Proteins

Key Properties

SourceEscherichia Coli
Biological ActivityTRX activity is assayed by measuring the change in absorbance at 650 nm at 25°C using 0.13µM bovine insulin containing 0.33mM DTT (pH 6.5).The specific activity was found to be 3IU/mg.
Protein SequenceHMSDKIIHL TDDSFDTDVLKADGAIL VDFW AEWCGPCKMIAPILDEI GKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGAL DANLA
PurityGreater than 90.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.

Storage & Handling

StorageStability: TRX although stable at 4°C for 3 weeks, should be stored desiccated below -18°C. Please prevent freeze thaw cycles
Form/AppearanceSterile Lyophilized Powder.
Buffer/PreservativesEach mg of protein contains 20mM phosphate buffer pH 7.4.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Thioredoxin-1, Trx-1, trxA, fipA, tsnC, b3781, JW5856.
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

E. coli TXN1 Protein (orb429039)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

20 μg
$ 250.00
100 μg
$ 350.00
1 mg
$ 1,310.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry