Cart summary

You have no items in your shopping cart.

DUOXA2 Rabbit Polyclonal Antibody (Biotin)

DUOXA2 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2092048

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2092048
CategoryAntibodies
DescriptionDUOXA2 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsIHC
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the following sequence RWFWLVRVLLSLFIGAEIVAVHFSAEWFVGTVNTNTSYKAFSAARVTARV
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW35 kDa
UniProt IDQ1HG44
Protein SequenceSynthetic peptide located within the following region: RWFWLVRVLLSLFIGAEIVAVHFSAEWFVGTVNTNTSYKAFSAARVTARV
NCBINP_997464
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesTDH5, SIMNIPHOM
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.