You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb8250 |
---|---|
Category | Proteins |
Description | Recombinant of drosophila lush protein |
Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 19.2 kDa |
UniProt ID | O02372 |
Protein Sequence | MTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNFPPSQDLMCYTKCVSLMAGTVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENADGQFMWP |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Biological Origin | Drosophila melanogaster (Fruit fly) |
Expression Region | 30-153aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | lush, Obp76a, Obp76c, CG8807, General odorant-bind Read more... |
Note | For research use only |
Application notes | Tag info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 30-153aaSequence Info: Full Length of Mature ProteinGlycerol content: 0.5 |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Drosophila melanogaster (Fruit fly) lush.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Drosophila melanogaster (Fruit fly) lush.