DNASE1L3 Rabbit Polyclonal Antibody

• Catalog Number: orb585093
• Category: Antibodies
• Description: Rabbit polyclonal antibody to DNASE1L3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 34kDa
• Target: DNASE1L3
• UniProt ID: Q13609
• Protein Sequence: Synthetic peptide located within the following region: DFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS
• NCBI: NP_004935
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: LSD, DHP2, SLEB16, DNAS1L3
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.

Positive control (+): Human liver (LI), Negative control (-): Human lung (LU), Antibody concentration: 3 ug/ml.

WB Suggested Anti-DNASE1L3 Antibody, Titration: 1.0 ug/ml, Positive Control: Placenta.