You have no items in your shopping cart.
Cart summary
DNAJB4 Peptide - middle region
Catalog Number: orb2001441
Product Properties
| Catalog Number | orb2001441 |
|---|---|
| Category | Proteins |
| Description | DNAJB4 Peptide - middle region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: DSEEMEIDGDPFSAFGFSMNGYPRDRNSVGPSRLKQDPPVIHELRVSLEE |
| UniProt ID | Q9UDY4 |
| MW | 38 kDa |
| Tested applications | WB |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | DjB4, HLJ1, DNAJW |
| Note | For research use only |
| NCBI | NP_008965.2 |
Images
Similar Products
Reviews
DNAJB4 Peptide - middle region (orb2001441)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review