DNAJA1 Peptide - C-terminal region

• Catalog Number: orb2000186
• Category: Proteins
• Description: DNAJA1 Peptide - C-terminal region
• Predicted Reactivity: Human
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized powder
• Protein Sequence: Synthetic peptide located within the following region: SPDKLSLLEKLLPERKEVEETDEMDQVELVDFDPNQERRRHYNGEAYEDD
• UniProt ID: P31689
• MW: 45 kDa
• Application notes: This is a synthetic peptide designed for use in combination with DNAJA1 Rabbit Polyclonal Antibody (orb589865). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
• Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
• Alternative names: DJ-2, DjA1, HDJ2, HSDJ, HSJ2, HSJ-2, HSPF4, NEDD7,
• Note: For research use only
• NCBI: NP_001530.1
• Expiration Date: 6 months from date of receipt.