You have no items in your shopping cart.
[Des-His1, Glu9] - Glucagon (1 - 29), amide
SKU: orb2694473
Description
Images & Validation
−![[Des-His1, Glu9] - Glucagon (1 - 29), amide](/images/quality_badge_proteins.png)
Key Properties
−| Target | GCCR |
|---|---|
| Molecular Weight | 3358.72 |
| Protein Sequence | SQGTFTSEYSKYLDSRRAQDFVQWLMNT-NH2 |
| Purity | ≥95% |
Storage & Handling
−| Expiration Date | 6 months from date of receipt. |
|---|---|
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
GCCR
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
[Des-His1, Glu9] - Glucagon (1 - 29), amide (orb2694473)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review