Cart summary

You have no items in your shopping cart.

DDIAS Rabbit Polyclonal Antibody (FITC)

DDIAS Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2094036

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2094036
CategoryAntibodies
DescriptionDDIAS Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityCanine, Guinea pig, Human, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of human DDIAS
Protein SequenceSynthetic peptide located within the following region: AFKKPVFYSDLDGNYEKIRIFPENDKQQASPSCPKNIKTPSQKIRSPIVS
UniProt IDB4DMA1
MW76kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesnoxin, C11orf82
NoteFor research use only
NCBIXP_011543139.1