You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2012031 |
---|---|
Category | Proteins |
Description | D4S234E Peptide - N-terminal region |
Predicted Reactivity | Human |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized powder |
Protein Sequence | MVKLGNNFAEKGTKQPLLEDGFDTIPLMTPLDVNQLQFPPPDKVVVKTKT |
UniProt ID | P42857 |
MW | 21kDa |
Tested applications | WB |
Application notes | This is a synthetic peptide designed for use in combination with D4S234E Rabbit Polyclonal Antibody (orb579340). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
Alternative names | D4S234, NEEP21, NSG1, P21, D4S234E |
Note | For research use only |
NCBI | NP_001035190 |