Cart summary

You have no items in your shopping cart.

D15Wsu75e Rabbit Polyclonal Antibody (Biotin)

D15Wsu75e Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2117035

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2117035
CategoryAntibodies
DescriptionD15Wsu75e Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human D15Wsu75e
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW18kDa
UniProt IDQ6ICB0
Protein SequenceSynthetic peptide located within the following region: FLTGRKIPSYITDLPSEVLSTPFGQALRPLLDSIQIQPPGGSSVGRPNGQ
NCBINP_056519
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesPOST, DESI2, DeSI-1, PPPDE2, FAM152B, D15Wsu75e, D
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.