You have no items in your shopping cart.
CYP7B1 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Porcine, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CYP7B1 |
| Target | CYP7B1 |
| Protein Sequence | Synthetic peptide located within the following region: AMYYLLRHPEAMAAVRDEIDRLLQSTGQKKGSGFPIHLTREQLDSLICLE |
| Molecular Weight | 58kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−CYP7B1 rabbit pAb Antibody [orb770913]
ELISA, IF, IHC, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μlCYP7B1 Antibody [orb626207]
ELISA, IF, IHC, WB
Human, Mouse
Rabbit
Polyclonal
Unconjugated
100 μg, 50 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

WB Suggested Anti-CYP7B1 Antibody, Titration: 1.0 ug/ml, Positive Control: 721_B Whole Cell, CYP7B1 is supported by BioGPS gene expression data to be expressed in 721_B.
Documents Download
Request a Document
Filter by Applications
Filter by Species
Yuzhong Du 1, Jie Su 2, Meiqiu Yan 2, Qirui Wang 2, Ting Wang 3, Su Gao 2, Yajuan Tian 2, Yibei Wang 2, Suhong Chen 4, Guiyuan Lv 5, Jingjing Yu Polymethoxyflavones in citrus extract has a beneficial effect on hypercholesterolemia rats by promoting liver cholesterol metabolism J Ethnopharmacol ., (2024)
Applications
Reactivity
CYP7B1 Rabbit Polyclonal Antibody (orb331111)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review




