You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2008076 |
---|---|
Category | Proteins |
Description | CYP4F2 Peptide - C-terminal region |
Predicted Reactivity | Human |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized powder |
Protein Sequence | QAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGL |
UniProt ID | P78329 |
MW | 60kDa |
Tested applications | WB |
Application notes | This is a synthetic peptide designed for use in combination with CYP4F2 Rabbit Polyclonal Antibody (orb585744). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
Alternative names | CPF2 |
Note | For research use only |
NCBI | NP_001073 |