Cart summary

You have no items in your shopping cart.

CYP46A1 Rabbit Polyclonal Antibody (Biotin)

CYP46A1 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2120374

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2120374
CategoryAntibodies
DescriptionCYP46A1 Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human CYP46A1
Protein SequenceSynthetic peptide located within the following region: YVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQM
UniProt IDQ9Y6A2
MW57kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesCP46, CYP46
NoteFor research use only
NCBINP_006659