You have no items in your shopping cart.
Cart summary
CYP39A1 Peptide - middle region
Catalog Number: orb1998235
| Catalog Number | orb1998235 |
|---|---|
| Category | Proteins |
| Description | CYP39A1 Peptide - middle region |
| Predicted Reactivity | Mouse |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: PGVITRKVVKPVKILNHTVPSGDLLMLSPFWLHRNPKYFPEPESFKPERW |
| UniProt ID | Q9JKJ9 |
| MW | 54 kDa |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | Mcyp39a1 |
| Note | For research use only |
| NCBI | NP_061375.1 |
