You have no items in your shopping cart.
Cart summary
CYP27A1 Peptide - N-terminal region
Catalog Number: orb2002925
| Catalog Number | orb2002925 |
|---|---|
| Category | Proteins |
| Description | CYP27A1 Peptide - N-terminal region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: GKYPVRNDMELWKEHRDQHDLTYGPFTTEGHHWYQLRQALNQRLLKPAEA |
| UniProt ID | Q02318 |
| MW | 58kDa |
| Tested applications | WB |
| Application notes | This is a synthetic peptide designed for use in combination with CYP27A1 Rabbit Polyclonal Antibody (orb588090). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | CYP27A1,CYP27, |
| Note | For research use only |
| NCBI | NP_000775 |
| Expiration Date | 6 months from date of receipt. |
