Cart summary

You have no items in your shopping cart.

CYP26A1 Peptide - N-terminal region

SKU: orb2002918

Description

CYP26A1 Peptide - N-terminal region

Images & Validation

Tested ApplicationsWB
Application Notes
This is a synthetic peptide designed for use in combination with CYP26A1 Rabbit Polyclonal Antibody (orb584590). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Key Properties

Molecular Weight54kDa
Protein SequenceSynthetic peptide located within the following region: HRLVSVHWPASVRTILGSGCLSNLHDSSHKQRKKVIMRAFSREALECYVP

Storage & Handling

StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
DisclaimerFor research use only

Alternative Names

CYP26A1,CYP26,P450RAI1,
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

CYP26A1 Peptide - N-terminal region (orb2002918)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μg
$ 230.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry