You have no items in your shopping cart.
Page Not Found
Cart summary
CYP11B2 Peptide - middlel region
Catalog Number: orb1997673
| Catalog Number | orb1997673 |
|---|---|
| Category | Proteins |
| Description | CYP11B2 Peptide - middlel region |
| Predicted Reactivity | Mouse |
| Form/Appearance | Lyophilized powder |
| MW | 57 kDa |
| UniProt ID | P15539 |
| Protein Sequence | Synthetic peptide located within the following region: ISQGSLPLDAIKANSMELTAGSVDTTAIPLVMTLFELARNPDVQKALRQE |
| NCBI | NP_034121.3 |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Buffer/Preservatives | Lyophilized powder |
| Alternative names | Cpn2, Cyp11b, Cyp11b-2 Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
