You have no items in your shopping cart.
Cart summary
CXCR1 Peptide - middle region
Catalog Number: orb2000858
| Catalog Number | orb2000858 |
|---|---|
| Category | Proteins |
| Description | CXCR1 Peptide - middle region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: ILLLACISVDRYLAIVHATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLF |
| UniProt ID | C9JW47 |
| MW | 22 kDa |
| Tested applications | WB |
| Application notes | This is a synthetic peptide designed for use in combination with CXCR1 Rabbit Polyclonal Antibody (orb588912). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | C-C, CD128, CD181, CKR-1, IL8R1, IL8RA, CMKAR1, IL Read more... |
| Note | For research use only |
| NCBI | NP_000625.1 |
