Cart summary

You have no items in your shopping cart.

    Cthrc1 Antibody - C-terminal region : Biotin

    Cthrc1 Antibody - C-terminal region : Biotin

    Catalog Number: orb2098108

    DispatchUsually dispatched within 5-10 working days
    $ 632.00
    Catalog Numberorb2098108
    CategoryAntibodies
    DescriptionCthrc1 Antibody - C-terminal region : Biotin
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsWB
    Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
    ConjugationBiotin
    MW26kDa
    UniProt IDQ9D1D6
    Protein SequenceSynthetic peptide located within the following region: HRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEEL
    NCBINP_081054
    StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
    Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
    Alternative names1110014B07Rik
    Read more...
    NoteFor research use only
    Expiration Date12 months from date of receipt.
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars