You have no items in your shopping cart.
Cart summary
CSF2RB Peptide - middle region
Catalog Number: orb2000326
| Catalog Number | orb2000326 |
|---|---|
| Category | Proteins |
| Description | CSF2RB Peptide - middle region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: HTPEKQASSFDFNGPYLGPPHSRSLPDILGQPEPPQEGGSQKSPPPGSLE |
| UniProt ID | B4DZL8 |
| MW | 92 kDa |
| Application notes | This is a synthetic peptide designed for use in combination with CSF2RB Rabbit Polyclonal Antibody (orb589698). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | CD131, IL3RB, IL5RB, SMDP5, CDw131 |
| Note | For research use only |
| NCBI | NP_000386.1 |
