CRMP1 Rabbit Polyclonal Antibody

• Catalog Number: orb578278
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CRMP1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, IP, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CRMP1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 62kDa
• Target: CRMP1
• UniProt ID: Q14194
• Protein Sequence: Synthetic peptide located within the following region: SYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIV
• NCBI: NP_001304
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: DRP1, DRP-1, CRMP-1, DPYSL1, ULIP-3
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: 2. mouse brain extracts (80 ug), 3. rat brain extract (80 ug), Primary Antibody Dilution: 2 ug/ml, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody Dilution: 1:20000.

Sample Type: NT2 cells, Red: Antibody, Blue: DAPI, Primary Dilution: 1 ug/50 ul antibody, Secondary Antibody: Alexa goat anti-rabbit 594.

Rabbit Anti-CRMP1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Testis, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-CRMP1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate.