You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2008160 |
---|---|
Category | Proteins |
Description | CRISP1 Peptide - N-terminal region |
Predicted Reactivity | Human |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized powder |
Protein Sequence | ARIFSKYCDMTESNPLERRLPNTFCGENMHMTSYPVSWSSVIGVWYSEST |
UniProt ID | P54107 |
MW | 27kDa |
Tested applications | WB |
Application notes | This is a synthetic peptide designed for use in combination with CRISP1 Rabbit Polyclonal Antibody (orb582134). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
Alternative names | AEGL1, ARP, CRISP-1, HSCRISP1D, HSCRISP1G, HUMARP |
Note | For research use only |
NCBI | NP_001122 |
Expiration Date | 6 months from date of receipt. |