You have no items in your shopping cart.
Cart summary
CREB3L4 Peptide - middle region
Catalog Number: orb1998589
Product Properties
| Catalog Number | orb1998589 |
|---|---|
| Category | Proteins |
| Description | CREB3L4 Peptide - middle region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: HLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKEYIDGLESRVAACSAQN |
| UniProt ID | Q8TEY5 |
| MW | 43 kDa |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | JAL, hJAL, ATCE1, CREB3, CREB4, AIBZIP |
| Note | For research use only |
| NCBI | NP_001242907.1 |
| Expiration Date | 6 months from date of receipt. |
Images
Reviews
CREB3L4 Peptide - middle region (orb1998589)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review