Cart summary

You have no items in your shopping cart.

CREB3L4 Peptide - middle region

CREB3L4 Peptide - middle region

Catalog Number: orb1998589

Select Product Size
SizePriceQuantity
100 μg$ 230.00
100 μg Enquire
DispatchUsually dispatched within 5-10 working days
Product Properties
Catalog Numberorb1998589
CategoryProteins
DescriptionCREB3L4 Peptide - middle region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: HLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKEYIDGLESRVAACSAQN
UniProt IDQ8TEY5
MW43 kDa
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Alternative namesJAL, hJAL, ATCE1, CREB3, CREB4, AIBZIP
NoteFor research use only
NCBINP_001242907.1
Expiration Date6 months from date of receipt.
Images
Reviews

CREB3L4 Peptide - middle region (orb1998589)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet