You have no items in your shopping cart.
Cart summary
CRADD Peptide - middle region
Catalog Number: orb2002991
| Catalog Number | orb2002991 |
|---|---|
| Category | Proteins |
| Description | CRADD Peptide - middle region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: PAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYR |
| UniProt ID | P78560 |
| MW | 21kDa |
| Tested applications | WB |
| Application notes | This is a synthetic peptide designed for use in combination with CRADD Rabbit Polyclonal Antibody (orb587948). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | CRADD, RAIDD, |
| Note | For research use only |
| NCBI | NP_003796 |
