You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
CLCN6 Rabbit Polyclonal Antibody
Catalog Number: orb575447
| Catalog Number | orb575447 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to CLCN6 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CLCN6 |
| Concentration | 1.0 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 39kDa |
| Target | CLCN6 |
| UniProt ID | Q5SNX3 |
| Protein Sequence | Synthetic peptide located within the following region: PQFQSISLRKIQFNFPYFRSDRDKRDFVSAGAAAGVAAAFGAPIGGTLFS |
| NCBI | NP_068504 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | CLC-6, CONRIBA Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Lanes: 1. Human NT-2 cells (60 ug) lysate 2. Mouse WT brain extract (80 ug), Primary Antibody dilution: 2 ug/ml, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody dilution: 1:20000, Gene Name: CLCN6.
WB Suggested Anti-CLCN6 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.
- Item 1 of 2
Anti-CLCN6 Antibody [orb213748]
IH, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μl - Item 1 of 3
- Item 1 of 2
- Item 1 of 1
