You have no items in your shopping cart.
Cart summary
CLCF1 Peptide - N-terminal region
Catalog Number: orb1998874
| Catalog Number | orb1998874 |
|---|---|
| Category | Proteins |
| Description | CLCF1 Peptide - N-terminal region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| MW | 23 kDa |
| UniProt ID | Q9UBD9 |
| Protein Sequence | Synthetic peptide located within the following region: TVLWHLPAVPALNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLG |
| NCBI | NP_001159684.1 |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Buffer/Preservatives | Lyophilized powder |
| Alternative names | CLC, NR6, BSF3, NNT1, BSF-3, CISS2, NNT-1 Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
