You have no items in your shopping cart.
Cart summary
Cib1 Peptide - N-terminal region
Catalog Number: orb2005646
| Catalog Number | orb2005646 |
|---|---|
| Category | Proteins |
| Description | Cib1 Peptide - N-terminal region |
| Tested applications | WB |
| Predicted Reactivity | Human, Rat |
| Form/Appearance | Lyophilized powder |
| MW | 21kDa |
| UniProt ID | Q9R010 |
| Protein Sequence | Synthetic peptide located within the following region: GGSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPPEHRTVEESLHT |
| NCBI | NP_112407 |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Buffer/Preservatives | Lyophilized powder |
| Alternative names | Cib, Sip2-28 Read more... |
| Note | For research use only |
| Application notes | This is a synthetic peptide designed for use in combination with Cib1 Rabbit Polyclonal Antibody (orb580364). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Expiration Date | 6 months from date of receipt. |
