You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580545 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CSGlcA-T |
Target | CHPF2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Canine, Equine, Porcine, Rabbit |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CSGlcA-T |
Protein Sequence | Synthetic peptide located within the following region: SLLRVSWIQGEGEDPCVEAVGERGGPQNPDSRARLDQSDEDFKPRIVPYY |
UniProt ID | Q9P2E5 |
MW | 86kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | ChSy-3, chPF-2, CSGlcAT, CSGLCA-T |
Note | For research use only |
NCBI | EAW54012 |
WB Suggested Anti-CSGlcA-T Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Liver.
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF | |
Bovine, Equine, Gallus, Human, Mouse, Porcine, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
RBITC |