Chmp4c Rabbit Polyclonal Antibody

SKU: orb326595

Description

Chmp4c Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Chmp4c. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Chmp4c. This antibody reacts with Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Yeast, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Yeast, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Chmp4c
• Target: Chmp4c
• Protein Sequence: Synthetic peptide located within the following region: SEAFSQRVQFADGFDEAELLAELEELEQEELNKKMTSLELPNVPSSSLPA
• Molecular Weight: 26 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti 2010012P02Rik antibody, anti 2210015K02Rik antibody, anti 2310010I16Rik antibody, anti Shax3 antibody, anti Snf7-3 antibody

Quick Database Links

Gene Symbol

Chmp4c

UniProt

Q9D7F7

RefSeq (Protein):NP_079795