Chmp4c Rabbit Polyclonal Antibody

• Catalog Number: orb326595
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Chmp4c
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Chmp4c
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 26 kDa
• Target: Chmp4c
• UniProt ID: Q9D7F7
• Protein Sequence: Synthetic peptide located within the following region: SEAFSQRVQFADGFDEAELLAELEELEQEELNKKMTSLELPNVPSSSLPA
• NCBI: NP_079795
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti 2010012P02Rik antibody, anti 2210015K02Rik an
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Mouse tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Protein may be phosphorylated and migrates slightly higher than predicted molecular weight. Higher molecular weight bands may be intrachain crosslinked homodimers.

Sample Tissue: Mouse Mouse Spleen, Antibody Dilution: 1 ug/mL.

Sample Type: Mouse Liver lysates, Antibody Dilution: 1.0 ug/mL.