You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb326595 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Chmp4c |
Target | Chmp4c |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Yeast, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Chmp4c |
Protein Sequence | Synthetic peptide located within the following region: SEAFSQRVQFADGFDEAELLAELEELEQEELNKKMTSLELPNVPSSSLPA |
UniProt ID | Q9D7F7 |
MW | 26 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti 2010012P02Rik antibody, anti 2210015K02Rik an Read more... |
Note | For research use only |
NCBI | NP_079795 |
25 ug of the indicated Mouse tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Protein may be phosphorylated and migrates slightly higher than predicted molecular weight. Higher molecular weight bands may be intrachain crosslinked homodimers.
Sample Tissue: Mouse Mouse Spleen, Antibody Dilution: 1 ug/mL.
Sample Type: Mouse Liver lysates, Antibody Dilution: 1.0 ug/mL.
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Human, Mouse, Porcine, Rabbit | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish | |
Rabbit | |
Polyclonal | |
FITC |