You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb581770 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to CGAS |
| Target | CGAS |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Equine, Guinea pig, Porcine, Rabbit |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human C6orf150 |
| Protein Sequence | Synthetic peptide located within the following region: VPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDC |
| UniProt ID | Q8N884 |
| MW | 59kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | MB21D1, h-cGAS, C6orf150 |
| Research Area | Cancer, DNA Damage, Epigenetics, Immunology, Infec Read more... |
| Note | For research use only |
| NCBI | NP_612450 |

Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

Sample Type: Fetal Liver lysates, Antibody dilution: 0.2 ug/ml.

Sample Type: Jurkat Whole Cell lysates, Antibody dilution: 0.2 ug/ml.

Sample Type: Jurkat Whole Cell lysates, Antibody dilution: 0.2 ug/ml.

Sample Tissue: Human Jurkat, Antibody dilution: 1.0 ug/ml.
ELISA, IF, IHC-Fr, IHC-P | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review