You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb583496 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CENPN |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IF, WB |
Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CENPN |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 40 kDa |
Target | CENPN |
UniProt ID | Q96H22 |
Protein Sequence | Synthetic peptide located within the following region: SFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYS |
NCBI | NP_001094095 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | BM039, CENP-N, ICEN32, C16orf60 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 4 ug/ml of the antibody was used in this experiment. The protein may be modified by phosphorylation.
Sample Type: DNA/ACA.
Sample Type: Huh-7, Primary Antibody dilution: 4 ug/ml, Secondary Antibody: Anti-rabbit Alexa 546, Secondary Antibody dilution: 2 ug/ml, Gene Name: CENPN.
Sample Type: MCF7, Primary Antibody dilution: 4 ug/ml, Secondary Antibody: Anti-rabbit Alexa 546, Secondary Antibody dilution: 2 ug/ml, Gene Name: CENPN.
WB Suggested Anti-CENPN Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate. CENPN is supported by BioGPS gene expression data to be expressed in Jurkat.
IF, WB | |
Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |