CENPN Rabbit Polyclonal Antibody

SKU: orb583496

Description

Rabbit polyclonal antibody to CENPN

Research Area

Cell Biology

Images & Validation

• Tested Applications: IF, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CENPN
• Target: CENPN
• Protein Sequence: Synthetic peptide located within the following region: SFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYS
• Molecular Weight: 40 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

BM039, CENP-N, ICEN32, C16orf60

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 4 ug/ml of the antibody was used in this experiment. The protein may be modified by phosphorylation.

Sample Type: DNA/ACA.

Sample Type: Huh-7, Primary Antibody dilution: 4 ug/ml, Secondary Antibody: Anti-rabbit Alexa 546, Secondary Antibody dilution: 2 ug/ml, Gene Name: CENPN.

Sample Type: MCF7, Primary Antibody dilution: 4 ug/ml, Secondary Antibody: Anti-rabbit Alexa 546, Secondary Antibody dilution: 2 ug/ml, Gene Name: CENPN.

WB Suggested Anti-CENPN Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate. CENPN is supported by BioGPS gene expression data to be expressed in Jurkat.

Quick Database Links

Gene Symbol

CENPN

UniProt

Q96H22

RefSeq (Protein):NP_001094095