You have no items in your shopping cart.
Cecropin A
SKU: orb1147115
Description
Research Area
Microbiology
Images & Validation
−Item 1 of 1
Key Properties
−| Molecular Weight | 4003.8 Da |
|---|---|
| Protein Sequence | H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2 |
| Purity | > 95% by HPLC |
Storage & Handling
−| Storage | Store desiccated, frozen and in the dark |
|---|---|
| Form/Appearance | Freeze dried solid |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−80451-04-3AM080 , AMP, CeA, CeA), Cecropin A, H-KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2, Hyalophora cecropia, KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2, antimicrobial peptide, moths
Similar Products
−- Item 1 of 1
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Structure for Cecropin A
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Cecropin A (orb1147115)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days