Cart summary

You have no items in your shopping cart.

CEACAM8 Peptide - middle region

CEACAM8 Peptide - middle region

Catalog Number: orb2001621

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb2001621
CategoryProteins
DescriptionCEACAM8 Peptide - middle region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: TRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDA
UniProt IDP31997
MW38 kDa
Tested applicationsWB
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Alternative namesCD67, CGM6, CD66b, NCA-95,
NoteFor research use only
NCBINP_001807.2