CDK6 Rabbit Polyclonal Antibody

• Catalog Number: orb592687
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CDK6
• Target: CDK6
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CDK6
• Protein Sequence: Synthetic peptide located within the following region: LLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA
• UniProt ID: Q00534
• MW: 37kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: MCPH12, PLSTIRE
• Research Area: Cancer Biology, Cell Biology, Stem Cell & Developm
• Note: For research use only
• NCBI: NP_001250
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-CDK6 Antibody, Catalog Number: orb592687, Formalin Fixed Paraffin Embedded Tissue: Human Bone Marrow Tissue, Observed Staining: Cytoplasm, Nucleus, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-CDK6 Antibody Titration: 0.625 ug/ml, Positive Control: Jurkat cell lysate. CDK6 is supported by BioGPS gene expression data to be expressed in Jurkat.