You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb592687 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to CDK6 |
| Target | CDK6 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rabbit |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CDK6 |
| Protein Sequence | Synthetic peptide located within the following region: LLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA |
| UniProt ID | Q00534 |
| MW | 37kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | MCPH12, PLSTIRE |
| Research Area | Cancer Biology, Cell Biology, Stem Cell & Developm Read more... |
| Note | For research use only |
| NCBI | NP_001250 |
| Expiration Date | 12 months from date of receipt. |

Rabbit Anti-CDK6 Antibody, Catalog Number: orb592687, Formalin Fixed Paraffin Embedded Tissue: Human Bone Marrow Tissue, Observed Staining: Cytoplasm, Nucleus, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-CDK6 Antibody Titration: 0.625 ug/ml, Positive Control: Jurkat cell lysate. CDK6 is supported by BioGPS gene expression data to be expressed in Jurkat.
FC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review