CDK2 Rabbit Polyclonal Antibody

SKU: orb592688

Description

Rabbit polyclonal antibody to CDK2

Research Area

Cell Biology, Epigenetics & Chromatin, Molecular Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CDK2
• Target: CDK2
• Protein Sequence: Synthetic peptide located within the following region: SKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
• Molecular Weight: 34 kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CDKN2, p33(CDK2)

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The peptide sequence is present in a 30 kDa isoform. The protein may be modified by phosphorylation.

Sample Tissue: Human Hela Whole Cell, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-CDK2 Antibody Titration: 1 ug/ml, Positive Control: Jurkat cell lysate. CDK2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

Quick Database Links

Gene Symbol

CDK2

UniProt

P24941

RefSeq (Protein):NP_001789