You have no items in your shopping cart.
CD300c Recombinant Protein
SKU: orb1495160
Description
Research Area
Epigenetics, Immunology
Images & Validation
−
Key Properties
−| Expression System | E.coli |
|---|---|
| Tag | His-tag |
| Molecular Weight | ~24kDa |
| Protein Sequence | MGYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR |
| Purification | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Storage & Handling
−| Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | PBS, 4M Urea, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Recombinant Human LMIR2 Protein [orb2994006]
Unconjugated
SDS-PAGE: Greater than 90% as determined by reducing SDS-PAGE.
Predicted: 44.9 KDa. Observed: 50-85 KDa, reducing conditions
500 μg, 10 μg, 50 μg, 1 mgRecombinant Human LMIR2 Protein [orb2995075]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 18.89 KDa. Observed: 40 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg- Item 1 of 1
Human CD300C Protein, hFc Tag [orb2321399]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 44.0 kDa after removal of the signal peptide. The apparent molecular mass of CD300C-hFc is approximately 55-70 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg Recombinant Human CD300c Protein, C-Fc [orb2966387]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
46.48 kDa
1 mg, 50 μg, 100 μgRecombinant Human CD300c Protein, N-His [orb2968055]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
20.14 kDa
1 mg, 50 μg, 100 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
CD300c Recombinant Protein (orb1495160)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days