Cart summary

You have no items in your shopping cart.

Ccnb1ip1 Peptide - N-terminal region

Ccnb1ip1 Peptide - N-terminal region

Catalog Number: orb2005627

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb2005627
CategoryProteins
DescriptionCcnb1ip1 Peptide - N-terminal region
Tested applicationsWB
Predicted ReactivityHuman, Mouse
Form/AppearanceLyophilized powder
MW31kDa
UniProt IDD3Z3K2
Protein SequenceSynthetic peptide located within the following region: CEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPACNS
NCBINP_001104589
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Buffer/PreservativesLyophilized powder
Alternative namesGm288, Hei10, mei4
Read more...
NoteFor research use only
Application notesThis is a synthetic peptide designed for use in combination with Ccnb1ip1 Rabbit Polyclonal Antibody (orb583993). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Expiration Date6 months from date of receipt.