CBR3 Rabbit Polyclonal Antibody

• Catalog Number: orb330448
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CBR3
• Target: CBR3
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CBR3
• Protein Sequence: Synthetic peptide located within the following region: PGPVKTDMDGKDSIRTVEEGAETPVYLALLPPDATEPQGQLVHDKVVQNW
• UniProt ID: O75828
• MW: 30 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti CBR3 antibody, anti antibody
• Note: For research use only
• NCBI: NP_001227

Sample Tissue: Human U937 Whole Cell lysates, Antibody Dilution: 1 ug/mL.