You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581723 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CBLN4 |
Target | CBLN4 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CBLN4 |
Protein Sequence | Synthetic peptide located within the following region: HVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDK |
UniProt ID | Q9NTU7 |
MW | 22kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | CBLNL1 |
Note | For research use only |
NCBI | NP_542184 |
Human cortex
Immunohistochemistry with Human, cortex tissue at an antibody concentration of 5.0 ug/ml using anti-CBLN4 antibody (orb581723).
WB Suggested Anti-CBLN4 Antibody Titration: 1 ug/ml, Positive Control: Hela cell lysate.
IH, WB | |
Human, Mouse, Porcine, Primate, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Human, Monkey, Mouse | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |